PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.03G227700.1.p
Common NameGLYMA_03G227700, Glyma03g38660.2, LOC778182
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 419aa    MW: 46703.9 Da    PI: 7.8305
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.03G227700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.9e-181461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  Glyma.03G227700.1.p 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                         678*******************************************97 PP

2Myb_DNA-binding42.81.2e-1367110146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          rg+++++E+  +v++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Glyma.03G227700.1.p  67 RGAFSQQEENSIVELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                          89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.407965IPR017930Myb domain
SuperFamilySSF466896.88E-2912108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002493.1E-161461IPR001005SANT/Myb domain
CDDcd001674.20E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2465116IPR009057Homeodomain-like
SMARTSM007173.4E-1166114IPR001005SANT/Myb domain
PROSITE profilePS5129419.08766116IPR017930Myb domain
PfamPF002492.4E-1267111IPR001005SANT/Myb domain
CDDcd001677.75E-869109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENSIVE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPNTHQPLS EIENDKDKPL TADKSNQKAS NEVMSLVEPP KPKPIATTAT TSMPMDRHPL  180
EVSSTSKISS GNNNSTLDRF DSSITSSDMM GMGYFPFQHL NYGPNMGLTT TPNNTPLCFI  240
PSSTSSQMMS ELNSTMFHSM FPTHVKPTVS LHSNNNNNPS SISSDGVQNW EVGTISNNNN  300
NNNASKSNGS SSCSIQLQSS STITWGLQQA ESATKAEQED IKWSEYLNNT PFYLGTTPVQ  360
HQTTNSLYSS DEVKPETTGF IADESSTMSW HHSQHNFQPS EIYTKDLQRF SVAFGQTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.212640.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311860.0KT031186.1 Glycine max clone HN_CCL_14 MYB/HD-like transcription factor (Glyma03g38660.2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304574.10.0transcription factor MYB86
TrEMBLI1JR100.0I1JR10_SOYBN; MYB/HD-like transcription factor
STRINGGLYMA03G38660.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-109myb domain protein 61
Publications ? help Back to Top
  1. Chai C, et al.
    Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance.
    BMC Genomics, 2015. 16: p. 596
    [PMID:26268547]